PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sobic.007G013800.1.p
Common NameSb07g001250, SORBIDRAFT_07g001250
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Sorghinae; Sorghum
Family MIKC_MADS
Protein Properties Length: 223aa    MW: 25152 Da    PI: 7.552
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sobic.007G013800.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF76.81.7e-241056248
                          ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEE CS
                SRF-TF  2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklye 48
                          rien   rqvtf+kRr+g+lKKA ELSvLCda + +iifs +gkly+
  Sobic.007G013800.1.p 10 RIENPVHRQVTFCKRRAGLLKKARELSVLCDAHIGIIIFSAHGKLYD 56
                          8********************************************97 PP

2K-box49.32.1e-17871711699
                 K-box  16 slqqelakLkkeienLqreqRhllGedLe.sLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkkle 99 
                             +qe   L++ei+ Lq+ +R + G+  +  +++ eL+ Le+ Le  + +iRs K+++++++i+ l+ ke +l+ +n+ Lr+k+ 
  Sobic.007G013800.1.p  87 DPKQETMVLQQEINLLQKGLRYIYGNRANeHMNVDELNALERYLEIWMYNIRSAKMQIMIQEIQALKSKEGMLKAANEILREKIV 171
                           5689999******************998626****************************************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006629.352161IPR002100Transcription factor, MADS-box
SuperFamilySSF554555.62E-27175IPR002100Transcription factor, MADS-box
SMARTSM004328.1E-35160IPR002100Transcription factor, MADS-box
CDDcd002652.79E-39279No hitNo description
PRINTSPR004044.2E-26323IPR002100Transcription factor, MADS-box
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PfamPF003193.4E-231055IPR002100Transcription factor, MADS-box
PRINTSPR004044.2E-262338IPR002100Transcription factor, MADS-box
PRINTSPR004044.2E-263859IPR002100Transcription factor, MADS-box
PROSITE profilePS5129710.9485176IPR002487Transcription factor, K-box
PfamPF014866.1E-2188170IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010228Biological Processvegetative to reproductive phase transition of meristem
GO:0048364Biological Processroot development
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 223 aa     Download sequence    Send to blast
MARGKVQLRR IENPVHRQVT FCKRRAGLLK KARELSVLCD AHIGIIIFSA HGKLYDLATT  60
GTMEELIDRY KTASGEAADG SGDNRMDPKQ ETMVLQQEIN LLQKGLRYIY GNRANEHMNV  120
DELNALERYL EIWMYNIRSA KMQIMIQEIQ ALKSKEGMLK AANEILREKI VEQSSLLDVG  180
MVVADQQNGH FSTVPLIEEI TNPLTILSGY SNCRGSEMGY SF*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3kov_A3e-15370268Myocyte-specific enhancer factor 2A
3kov_B3e-15370268Myocyte-specific enhancer factor 2A
3kov_I3e-15370268Myocyte-specific enhancer factor 2A
3kov_J3e-15370268Myocyte-specific enhancer factor 2A
3mu6_A2e-15370268Myocyte-specific enhancer factor 2A
3mu6_B2e-15370268Myocyte-specific enhancer factor 2A
3mu6_C2e-15370268Myocyte-specific enhancer factor 2A
3mu6_D2e-15370268Myocyte-specific enhancer factor 2A
3p57_A3e-15370268Myocyte-specific enhancer factor 2A
3p57_B3e-15370268Myocyte-specific enhancer factor 2A
3p57_C3e-15370268Myocyte-specific enhancer factor 2A
3p57_D3e-15370268Myocyte-specific enhancer factor 2A
3p57_I3e-15370268Myocyte-specific enhancer factor 2A
3p57_J3e-15370268Myocyte-specific enhancer factor 2A
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKJ7278960.0KJ727896.1 Zea mays clone pUT5990 MADS transcription factor (MADS45) mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002443744.11e-166hypothetical protein SORBIDRAFT_07g001250
SwissprotA2YQK91e-152MAD26_ORYSI; MADS-box transcription factor 26
SwissprotQ0J8G81e-152MAD26_ORYSJ; MADS-box transcription factor 26
TrEMBLC5YLY71e-166C5YLY7_SORBI; Putative uncharacterized protein Sb07g001250
STRINGSb07g001250.11e-165(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP149136112
Representative plantOGRP1617761
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G71692.18e-66AGAMOUS-like 12